index massa tubuh

DISTRIBUTOR HERBALIFE
TERMURAH & ORIGINAL
-------------------------------------------------
Untuk order :
HP/SMS/WA : 0813 2011 2028
BBM : 54F4CE77 | Line : ProgramLangsing


PAKET HERBALIFE

Pilihan paket Herbalife yang bisa Anda pilih sesuai kebutuhan


PRODUK HERBALIFE

Produk-produk Herbalife ini sudah bersertifikat FDA, TGA, GMP dari USA & BPOM dari Indonesia. Dan pastinya tidak mudah untuk produk-produk yang bisa mendapatkan sertifikat ini.


 

Perawatan index massa tubuh Kesehatan

KEDOKTERANKEBIDANANKEPERAWATANFARMASIANALISASKES

Obat dexaharsen Obat Dexaharsen | Dexametason Obat cyclo progynova Obat Cyclo Progynova | Terapi Sulit Hormon Rumus tetesan infus Cara Menghitung Tetesan Infus Obat vometa Obat Vometa | Domperidone

Indeks massa tubuh

NO

COMMENTS

 

Share Tweet Share

HomeKedokteranIndeks Massa Tubuh Menurut WHO dan Asia

Indeks Massa Tubuh Menurut WHO dan AsiaBY AKHMAD ARIF AFIF A.MD KEP KEDOKTERAN NO COMMENTS

 

 

Indeks massa tubuh

Ilustrasi Alat ukur TB dan BB.

PerawatanKesehatan.com – Mengukur lemak tubuh secara langsung sangatlah sulit dan sebagai pengukur pengganti dipakai indeks massa tubuh (IMT) untuk mengukur berat badan lebih dan obesitas (kegemukan) pada orang dewasa. Indeks massa tubuh merupakan indikator yang paling sering dipakai untuk mengetahui status gizi seseorang, apakah berar berat badan berlebih atau obesitas. Pada seseorang yang lebih besar tinggi dan gemuk, akan lebih berat dari pada index massa tubuh orang yang lebih kecil. Rumus Indeks Massa Tubuh. Cara mengukur indeks massa tubuh (IMT), yaitu berat badan dalam kilogram (kg) dibagi tinggi badan dalam meter kuadrat (m2) [1]. IMT = BB (kg) / TB (m 2). Karena IMT menggunakan ukuran berat dan tinggi badan, maka dalam pengukurannya harus dilakukan dengan sangat teliti. Status gizi berdasarkan indeks massa tubuh (IMT).

 

Status gizi kurang tingkat berat = < 17. Status gizi kurang tingkat ringan = 17-18,5. Status gizi kurang = 18,5 atau index massa tubuh kurang. Status gizi kurang = 18.5-24,9. Status gizi lebih = 25,0-27,0. [2] Kelompok berat badan lebih dan obesitas pada orang dewasa berdasarkan indeks massa tubuh menurut WHO (organisasi kesehatan dunia), nilai IMT 30 kg/m^2 dikatakan sebagai obesitas. Sedangkan nilai IMT 25-29,9 kg/m^2, dikatakan sebagai pra obese. Tetapi. Sebaiknya nilai IMT untuk bangsa Indonesia, Thailand, China, dan Ethiopia adalah 1,9, 4,6, 3,2 dan 2,9 kg/m^2 lebih rendah dibandingkan dengan ras berkulit putih.Tabel 1. Kategori Indeks Massa Tubuh (IMT) Menurut WHO.

 

Kategori.              IMT (kg/m2).

Berat badan kurang.       < 18,5.

Kisaran normal. 18,5-24,9.

Berat badan lebih.           > 25.

Pra-Obes.            25,0-29,9.

Obesitas tingkat 1.           30,0-34,9.

Obesitas tingkat 2.           35,0-39,0.

Obesitas tingkat 3.           > 40.

© WHO technical series, 2000.

 

 

 

Tabel 2. Kategori Indeks Massa Tubuh (IMT) menurut Asia Pasifik.

 

Kategori.              IMT (kg/m2).

Berat badan kurang.       < 18,5.

Kisaran normal. 18,5-22,9.

Berat badan lebih.           > 23,0.

Beresiko.             23,0-24,9.

Obesitas tingkat I.            25,0-29,9.

Obesitas tingkat II.          > 30,0.

© WHO WPR/IASO/IOTF dalam The Asia-Pacific Perspective: Redefining Obesity & its Treatment (2000).

 

 

 

Referensi.

 

Buku Ajar Ilmu Penyakit Dalam. Edisi IV. Jakarta : Fakultas Kedokteran Universitas Indonesia. 2006.

Materi Pelatihan Hiperkes dan Keselamatan Kerja Bagi Paramedis. Pusat Hiperkes dan KK Disnakertrans Provinsi DKI Jakarta. 2012.

Baca juga selanjutnya: Penyebab obesitas.

 

 

 

Dibaca: 3,388

Bagikan ini:

Click to share on Twitter (Opens in new window)Click to share on Facebook (Opens in new window)Click to share on Google+ (Opens in new window)

Kematian mendadak

RECOMMENDED FOR YOU

Penyebab Kematian Mendadak

AKHMAD ARIF AFIF A.MD KEP

 

Akhmad Arif Afif A.Md Kep

Related Posts

 

penyakit influenza

Penyakit Influenza (Flu)

AKHMAD ARIF AFIF A.MD KEP

Kematian mendadak

Penyebab Kematian Mendadak

AKHMAD ARIF AFIF A.MD KEP

Demam dengue dan demam berdarah dengue

Demam Dengue Dengan Demam Berdarah Dengue

AKHMAD ARIF AFIF A.MD KEP

Penyakit jantung pada kehamilan

Penyakit Jantung Pada Kehamilan

SHOLIKHAH AINI A.MD KEB

Reply

 

Comment Text*

 

Name*

 

Email*

 

Website

SUBMIT Notify me of follow-up comments by email. Notify me of new posts by email.

 

 

Banyak Dibaca

 

tekanan darah tinggi

Asuhan Keperawatan Hipertensi (Tekanan Darah Tinggi)

0

mioma uteri dalam kehamilan

Cara Mengatasi dan Penyebab Mudah Lelah dan …

0

traveling saat hamil

Tips Aman Traveling Saat Hamil

0

Tpis mengatasi pusing saat hamil muda

Tips Mencegah Rambut Rontok Saat Hamil

0

Stretch-Marks-atau-guratan-kulit-saat-hamil

Stretch Marks (Guratan Pada Kulit) Saat Hamil

0

Masih Hangat

 

IMG_20160830_123917

0

mioma uteri dalam kehamilan

0

traveling saat hamil

0

Tpis mengatasi pusing saat hamil muda

0

Stretch-Marks-atau-guratan-kulit-saat-hamil

0

Video Terbaru

 

 

Langganan Artikel

 

 

Masukkan Email Anda

LANGGANAN (GRATIS)

PERAWATAN KESEHATAN

 

Perawatankesehatan.com adalah website / blog yang membahas tentang pencegahan penyakit, perawatan, kebidanan, dst…

 

DAFTAR FORUM

 

Diskusi Farmasi

Diskusi Kebidanan

Diskusi Kedokteran

Diskusi Keperawatan

Diskusi Pelayanan Kesehatan

Konsultasi

KOMENTAR

 

Sholikhah Aini A.md Keb on Gagal Jantung (GJ)

pengobatan beri-beri on Gagal Jantung (GJ)

Sholikhah Aini A.md Keb on Obat Cyclo Progynova | Terapi Sulit Hormon

Perawatan Kesehatan Copyright © 2016.

Website ini dikelola oleh Tenaga Kesehatan.

 

 

Metty Andriyani’s Files

 

SELASA, 01 JUNI 2010

Indeks Massa Tubuh (IMT)

Rata Penuh

Ada beberapa cara yang dapat dilakukan untuk mengukur status gizi / tingkat kesehatan seseorang, salah satunya yaitu metode pengukuran Body Mass Index (BMI) / Indeks Massa Tubuh (IMT). Variabel yang digunakan untuk pengukuran ini adalah berat dan tinggi badan.

 

Pengertian

Indeks massa tubuh adalah suatu pengukuran yang membandingkan berat badan seseorang yang dibagi dengan kuadrat dari tinggi index massa tubuh badannya. Metode ini bisa memperkirakan lemak tubuh, tetapi tidak dapat diartikan sebagai persentase yang pasti dari lemak tubuh. Metode ini sangat berguna untuk memperkirakan berat badan seseorang yang ideal dari hasil perbandingan dari berat badan dan tinggi badannya. Selain itu, Indeks massa tubuh merupakan alat atau cara yang sederhana untuk memantau status gizi remaja dan dewasa. Karena kemudahannya dalam pengukuran serta penghitungannya, maka metode ini telah digunakan secara luas sebagai alat untuk mengidentifikasi masalah berat badan dikalangan masyarakat seperti malnutrisi yang terjadi dimasyarakat.

 

Rumus menghitung Indeks Massa Tubuh :

 

 

Berat Badan (kg)

IMT= ————————————–

Tinggi Badan (m) X Tinggi Badan (m)

 

 

Sejarah Penemuan Metode Indeks Massa Tubuh

Metode ini ditemukan diantara tahun 1830 dan 1850 oleh ilmuwan Belgia yang bernama Adolphe Quetelet pada saat kursus pengembangan ilmu fisika sosial.

 

Penggunaan Metode Indeks index massa tubuh Massa Tubuh

Sebagai sebuah pengukuran, indeks massa tubuh menjadi sangat terkenal selama tahun 1950-an hingga 1960-an ketika obesitas mulai muncul di negara-negara barat yang sudah makmur. Metode ini menyediakan perhitungan matematika yang sederhana dari tingkat kegemukan atau kekurusan tubuh seseorang sehingga dapat membantu para professional di bidang kesehatan untuk berdiskusi secara lebih objektif dengan pasiennya.

Metode ini telah digunakan oleh badan kesehatan dunia (WHO) sejak tahun 1980-an sebagai standar untuk mencatat tingkat kegemukan dari penduduk dunia. Di Amerika Serikat, metode ini juga digunakan untuk mengukur tingkat kekurusan tubuh terutama bagi para penderita penyakit kelainan makan seperti anorexia nervosa dan bulimia nervosa.

 

Indeks massa tubuh mengukur kadar lemak tubuh menggunakan sebuah rumus yang menghitung perbandingan dari tinggi dan berat badan. Sehingga hasil index massa tubuh dari penghitungan terhadap indeks massa tubuh anda bisa menjadi suatu penunjuk kepada berat badan yang tepat yang sesuai dengan tinggi badan anda dan menjadi suatu penunjuk yang lebih dapat diandalkan daripada hanya mengukur berat badan saja. Jika jumlah indeks massa tubuh Anda diatas tingkat normal maka Anda mempunyai risiko yang lebih besar untuk mengidap penyakit degeneratif. Jika Anda sedang mencoba untuk menurunkan berat badan, maka metode pengukuran indeks massa tubuh ini bisa menjadi alat bantu yang sangat berguna bagi anda untuk mencapai target penurunan berat badan yang diinginkan dengan menggunakan hasil dari pengukuran anda untuk melihat apakah anda masuk kedalam kategori berat badan normal, kelebihan berat badan atau sudah masuk kedalam kategori obesitas. Kemudian lihat kategori dari berat badan normal untuk menetapkan target penurunan atau penambahan berat badan. Nilai dari pengukuran yang diperoleh tidak tergantung pada umur dan jenis kelamin.

 

Pengecualian Penggunaan Metode Indeks Massa Tubuh

Meskipun metode pengukuran indeks massa tubuh ini telah digunakan secara luas, namun metode ini tidak bisa diterapkan kepada beberapa kelompok umur seperti :

  1. Bayi
  2. Anak-anak yang masih dalam masa pertumbuhan
  3. Remaja awal
  4. Wanita yang sedang hamil
  5. Orang lanjut usia
  6. Atlet

 

Klasifikasi Indeks Massa Tubuh

Indeks massa tubuh merupakan sebuah metode sederhana yang digunakan untuk mengklasifikasi berbagai tingkatan dari berat badan, seperti berat badan kurang, kelebihan berat badan dan obesitas pada orang dewasa. Metode ini didefinisikan sebagai pembagian antara berat badan dalam satuan kilogram dengan kuadrat tinggi badan dalam satuan meter.

Berikut ini adalah sebuah tabel yang menjelaskan klasifikasi hasil dari pengukuran indeks massa tubuh menurut standar yang telah ditetapkan oleh World Health Organization ( WHO ) yaitu sebuah Badan Kesehatan Dunia milik Persatuan Bangsa-bangsa ( PBB ).

 

*Klasifikasi BMI Menurut WHO (1998)

 

Kategori BMI (kg/m2)

 

Underweight < 18.5

Normal 18.5 – 24.9

Overweight > 25

Pre-obese 25.0 – 29.9

Obese I 30.0 – 34.9

Obese II 35.0 – 39.9

Obese III > 40.0

 

 

Para ahli sedang memikirkan untuk membuat klasifikasi tersendiri untuk penduduk Asia. Hasil studi di Singapura memperlihatkan bahwa orang Singapura dengan IMT 27 – 28 mempunyai lemak tubuh yang sama dengan orang-orang kulit putih dengan IMT 30. Pada orang India, peningkatan IMT dari 22 menjadi 24 dapat meningkatkan prevalensi DM menjadi 2 kali lipat, dan prevalensi ini naik menjadi 3 kali lipat pada orang dengan IMT 28.

 

*Klasifikasi Berat Badan yang diusulkan berdasarkan BMI pada

Penduduk Asia Dewasa (IOTF, WHO 2000)

 

Kategori BMI (kg/m2)

 

Underweight < 18.5

Normal 8.5 – 22.9

Overweight > 23

At Risk 23.0 – 24.9

Obese I 25.0 – 29.9

Obese II > 30.0

 

dikutip dari berbagai sumber.

 

Diposkan oleh Metty Andriyani di 6/01/2010 03:20:00 AM

3 komentar:

 

taufan angga dewantara21 September 2010 00.26

punya tabel IMT untuk anak Remaja dibawah 18 tahun..karena selama ini kebanyakan orang2 menggunakan IMT orang dewasa untuk menghitung IMT Anak2

 

Balas

 

freddy pangaribuan20 Januari 2013 19.44

helpful,thx

 

Balas

 

yusi angra2 Juni 2014 23.38

IMT kan gak boleh buat under 18. ya kan?

 

Balas

 

Beranda

Langganan: Poskan Komentar (Atom)

PENGIKUT

 

MENGENAI SAYA

Foto saya

Metty Andriyani

SDN 4 Stg ’00 SLTP 2 Stg ’03 SMA 1 Stg ’06 Poltekkes Depkes Pnk ’09

Lihat profil lengkapku

ARSIP BLOG

▼  2010 (1)

▼  Juni (1)

Indeks Massa Tubuh (IMT)

Template Jendela Gambar. Diberdayakan oleh Blogger.

 

 

Ceria Cemerlang

 

 

Beranda

Rabu, 04 Januari 2012

 

index masa tubuh (kel X)

 

  1. Pengertian

Pembangunan Sumber Daya manusia (SDM) merupakan salah satu prioritas pembangunan nasional. Perhatian utama adalah untuk mempersiapkan dan meningkatkan kualitas penduduk usia kerja agar benar-benar memperoleh kesempatan serta turut berperan dan memiliki kemampuan untuk mewujudkan hal tersebut adalah pembangunan di bidang kesehatan dan gizi.

DISTRIBUTOR HERBALIFE
TERMURAH & ORIGINAL
-------------------------------------------------
Untuk order :
HP/SMS/WA : 0813 2011 2028
BBM : 54F4CE77 | Line : ProgramLangsing


PAKET HERBALIFE

Pilihan paket Herbalife yang bisa Anda pilih sesuai kebutuhan


PRODUK HERBALIFE

Produk-produk Herbalife ini sudah bersertifikat FDA, TGA, GMP dari USA & BPOM dari Indonesia. Dan pastinya tidak mudah untuk produk-produk yang bisa mendapatkan sertifikat ini.


Masalah kekurangan dan kelebihan gizi pada orang dewasa (usia 18 tahun keatas) merupakan masa penting, karena selain mempunyai resiko penyakit-penyakit tertentu, juga dapat mempengaruhi produktifitas kerjanya. Oleh karena itu pemantauan keadaan tersebut perlu dilakukan oleh setiap orang secara berkesinambungan.

Indeks Massa Tubuh (IMT) atau Body Mass Index (BMI) merupakan alat atau cara yang sederhana untuk memantau status gizi orang dewasa, khususnya yang berkaitan index massa tubuh dengan kekurangan dan kelebihan berat badan. Berat badan kurang dapat meningkatkan resiko terhadap penyakit infeksi, sedangkan berat badan lebih akan meningkatkan resiko terhadap penyakit degeneratif. Oleh karena itu, mempertahankan berat badan normal memungkinkan seseorang dapat mencapai usia harapan hidup yang lebih panjang. Indeks massa tubuh (IMT) adalah nilai yang diambil dari perhitungan antara berat badan (BB) dan tinggi badan (TB) seseorang. IMT dipercayai dapat menjadi indikator atau B. mengambarkan kadar adipositas dalam tubuh seseorang.

IMT merupakan altenatif untuk tindakan pengukuran lemak tubuh karena murah serta metode skrining kategori berat badan yang mudah dilakukan. Untuk mengetahui nilai IMT ini, dapat dihitung dengan rumus berikut:

Menurut rumus metrik:

Berat badan (Kg)

IMT = ——————————————————-

[Tinggi badan (m)]2

 

 

 

 

The World Health Organization (WHO) pada tahun 1997, The National Institute of Health (NIH) pada tahun 1998 dan The Expert Committee on Clinical index massa tubuh Guidelines for Overweight in Adolescent Preventive Services telah merekomendasikan Body Mass Index (BMI) atau Indeks Massa Tubuh (IMT) sebagai baku pengukuran obesitas pada anak dan remaja di atas usia 2 tahun. IMT merupakan petunjuk untuk menentukan kelebihan berat badan berdasarkan Indeks Quatelet (berat badan dalam kilogram dibagi dengan kuadrat tinggi badan dalam meter(kg/m2)). Interpretasi IMT tergantung pada umur dan jenis kelamin anak, karena anak lelaki dan perempuan memiliki lemak tubuh yang berbeda.18 Berbeda dengan orang dewasa, IMT pada anak berubah sesuai umur dan sesuai dengan peningkatan panjang dan berat badan. Baru-baru ini The Centers for Disease Control (CDC) mempublikasikan kurva IMT. IMT dapat diplotkan sesuai jenis kelamin pada kurva pertumbuhan CDC untuk anak berusia 2-20 tahun.

IMT adalah cara termudah untuk memperkirakan obesitas serta berkorelasi tinggi dengan massa lemak tubuh, selain itu juga penting untuk mengidentifikasi pasien obesitas yang mempunyai risiko mendapat komplikasi medis. IMT mempunyai keunggulan utama yakni menggambarkan lemak tubuh yang berlebihan, sederhana dan bisa digunakan dalam penelitian populasi berskala besar. Pengukurannya hanya membutuhkan 2 hal yakni berat badan dan tinggi badan, yang keduanya dapat dilakukan secara akurat oleh seseorang dengan sedikit latihan. Keterbatasannya adalah membutuhkan penilaian lain bila dipergunakan secara individual.

Salah satu keterbatasan IMT adalah tidak bisa membedakan berat yang berasal dari lemak dan berat dari otot atau tulang. IMT juga tidak dapat mengidentifikasi distribusi dari lemak tubuh. Sehingga beberapa penelitian menyatakan bahwa standar cut off point untuk mendefinisikan obesitas berdasarkan IMT mungkin tidak menggambarkan risiko yang sama untuk konsekuensi kesehatan pada semua ras atau kelompok etnis.

Klasifikasi IMT terhadap umur adalah sebagai berikut : < persentil ke-5 adalah berat badan kurang, persentil ke-85 adalah overweight, dan persentil ke-95 adalah obesitas.

 

Jenis Obesitas berdasarkan Bentuk Tubuh

Cara lain untuk mengetahui distribusi lemak tubuh adalah index massa tubuh dengan cara melihat bentuk tubuh. Terdapat 3 macam bentuk tubuh berdasarkan karakteristik  distribusi lemak.

 

  1. Gynoid (Bentuk Peer)

http://www.obesitas.web.id/images/pear.gifLemak disimpan di sekitar pinggul dan bokong Tipe ini cenderung dimiliki wanita. Resiko terhadap penyakit pada tipe gynoid umumnya kecil, kecuali resiko terhadap penyakit arthritis dan varises vena (varicose veins).

 

  1. Apple Shape (Android)

http://www.obesitas.web.id/images/apple.gifBiasanya terdapat pada pria. dimana lemak tertumpuk di sekitar perut. Resiko kesehatan pada tipe ini lebih tinggi dibandingkan dengan tipe Gynoid, karena sel-sel lemak di sekitar perut lebih siap melepaskan lemaknya ke dalam pembuluh darah dibandingkan dengan sel-sel lemak di tempat lain. Lemak yang masuk ke dalam pembuluh darah dapat menyebabkan penyempitan arteri (hipertensi), diabetes, penyakit gallbladder, stroke, dan jenis kanker tertentu (payudara dan endometrium). Melihat hal tersebut di atas, dapat disimpulkan bahwa seorang pria kurus dengan perut gendut lebih beresiko dibandingkan dengan pria yang lebih gemuk dengan perut lebih kecil.

  1. http://www.obesitas.web.id/images/fruitbox.gifOvid (Bentuk Kotak Buah)

Ciri dari tipe ini adalah “besar di seluruh bagian badan”. Tipe Ovid umumnya terdapat pada orang-orang yang gemuk secara genetik

 

 

  1. Kategori Indeks Massa Tubuh

Untuk orang dewasa yang berusia 20 tahun keatas, IMT diinterpretasi menggunakan kategori status berat badan standard yang sama untuk semua umur bagi pria dan wanita. Untuk anak-anak dan remaja, intrepretasi IMT adalah spesifik mengikut usia dan jenis kelamin (CDC, 2009).

Istilah “normal”, “overweight” dan “obese”  dapat berbeda-beda, masing-masing negara dan budaya mempunyai kriteria sendiri-sendiri, oleh karena itu, WHO index massa tubuh menetapkan suatu pengukuran / klasifikasi obesitas yang tidak bergantung pada bias-bias kebudayaan. Metoda yang paling berguna dan banyak digunakan untuk mengukur tingkat obesitas adalah BMI (Body Mass Index), yang didapat dengan cara membagi berat badan (kg) dengan kuadrat dari tinggi badan (meter). Nilai BMI yang didapat tidak tergantung pada umur dan jenis kelamin.

Keterbatasan BMI adalah tidak dapat digunakan bagi:

  • Anak-anak yang dalam masa pertumbuhan
  • Wanita hamil
  • Orang yang sangat berotot, contohnya atlet

BMI dapat digunakan untuk menentukan seberapa besar seseorang dapat terkena resiko penyakit tertentu yang disebabkan karena berat badannya. Seseorang dikatakan obese dan membutuhkan pengobatan bila mempunyai BMI di atas 30, dengan kata lain orang tersebut memiliki kelebihan BB sebanyak 20%.

 

 

Klasifikasi BMI Menurut WHO (1998)

 

 

Kategori

BMI (kg/m2)

Resiko Comorbiditas

Underweight

< 18.5 kg/m2

Rendah (tetapi resiko terhadap masalah-masalah klinis lain meningkat)

Batas Normal

18.5 – 24.9 kg/m2

Rata-rata

Overweight:

> 25

 

Pre-obese

25.0 – 29.9 kg/m2

Meningkat

Obese I

30.0 – 34.9kg/m2

Sedang

Obese II

35.0 – 39.9 kg/m2

Berbahaya

Obese III

> 40.0 kg/m2

Sangat Berbahaya

 

Para ahli sedang memikirkan untuk membuat klasifikasi BMI tersendiri untuk penduduk Asia. Hasil studi di Singapura memperlihatkan bahwa orang Singapura dengan BMI 27 – 28 mempunyai lemak tubuh yang sama dengan orang-orang kulit putih dengan BMI 30. Pada orang India, peningkatan BMI dari 22  menjadi 24 dapat meningkatkan prevalensi DM menjadi 2 kali lipat,  dan prevalensi ini naik  menjadi 3 kali lipat pada orang dengan BMI 28.

Klasifikasi Berat Badan yang diusulkan berdasarkan BMI pada

Penduduk Asia Dewasa (IOTF, WHO 2000)

Kategori

BMI (kg/m2)

Risk of Co-morbidities

Underweight

< 18.5 kg/m2

Rendah (tetapi resiko terhadap masalah-masalah klinis lain meningkat)

Batas Normal

18.5 – 22.9 kg/m2

Rata rata

Overweight:

> 23

 

At Risk

23.0 – 24.9 kg/m2

Meningkat

Obese I

25.0 – 29.9kg/m2

Sedang

Obese II

> 30.0 kg/m2

Berbahaya

 

 

 

Secara umum, IMT 25 ke atas membawa arti pada obes. Standar baru untuk bawah 18,5 sebagai sangat kurus atau underweight, IMT melebihi 23 sebagai berat badan lebih atau overweight, dan IMT melebihi 25 sebagai obesitas. IMT yang ideal bagi orang dewasa adalah diantara 18,5 sehingga 22,9. Obesitas dikategorikan pada tiga tingkat: tingkat I (25-29,9), tingkat II (30-40), dan tingkat III (>40) (CDC, 2002).

 

 

Tipikal bentuk tubuh sesuai dengan IMT

IMT untuk laki-laki

 

IMT untuk wanita

 

 

  1. Kekurangan dan Kelebihan Indeks Massa Tubuh

Indeks massa tubuh (IMT) merupakan salah satu indikator yang dapat dipercayai untuk mengukur lemak tubuh. Meskipun demikian, terdapat beberapa kekurangan dan kelebihan dalam mnggunakan IMT sebagai indikator pengukuran lemak tubuh.

Kekurangan indeks massa tubuh adalah:

  1. Pada olahragawan: tidak akurat pada olahragawan (terutama atlet bina) yang cenderung berada pada kategori obesitas dalam IMT disebabkan mereka mempunyai massa otot yang berlebihan walaupun presentase lemah tubuh mereka dalam kadar yang rendah. Sedangkan dalam pengukuran berdasarkan berat badan dan tinggi badan, kenaikan nilai IMT adalah disebabkan oleh lemak tubuh.
  2. Pada anak-anak: tidak akurat karena jumlah lemak tubuh akan berubah seiringan dengan pertumbuhan dan perkembangan tubuh badan seseorang. Jumlah lemak tubuh pada lelaki dan perempuan juga berbeda selama pertumbuhan. Oleh itu, pada anak-anak dianjurkan untuk mengukur berat badan berdasarkan nilai persentil yang dibedakan atas jenis kelamin dan usia.
  3. Pada kelompok bangsa: tidak akurat pada kelompok bangsa tertentu karena harus dimodifikasi mengikut kelompok bangsa tertentu. Sebagai contoh IMT yang melebihi 23,0 adalah berada dalam kategori kelebihan berat badan dan IMT yang melebihi 27,5 berada dalam kategori obesitas pada kelompok bangsa seperti Cina, India, dan Melayu. (CORE, 2007).

 

Kelebihan indeks massa tubuh adalah:

  1. Biaya yang diperlukan tidak mahal
  2. Untuk mendapat nilai pengukuran, hanya diperlukan data berat badan dan tinggi badan seseorang.
  3. Mudah dikerjakan dan hasil bacaan adalah sesuai nilai standar yang telah dinyatakan pada table IMT.

 

 

 

 

 

Daftar pustaka

  • http://repository.usu.ac.id/bitstream/123456789/25638/4/Chapter%20II.pdf
  • http://www.obesitas.web.id/bmi%28i%29.html
  • http://www.obesitas.web.id/bmi%28i%29.html

 

Kirimkan Ini lewat Email

BlogThis!

Berbagi ke Twitter

Berbagi ke Facebook

Bagikan ke Pinterest

 

Tweet This!TWITTERShare on FacebookFACEBOOKDigg it!DIGGAdd to Delicious!DELICIOUSStumble itSTUMBLE

 

0 komentar:

 

Poskan Komentar

 

 

Posting Lebih Baru » « Posting Lama

Langganan: Poskan Komentar (Atom)

popular posts

 

Program Penanggulangan Gizi Buruk dari Pemerintah

  1. Pengertian GIZI BURUK adalah keadaan kekurangan energi dan protein (KEP) tingkat berat akibat kurang mengkonsumsi makanan ya…

PENGAWETAN DENGAN TEKNIK IRADIASI

Pengawetan Produk Makanan Dengan Iradiasi A.       PENDAHULUAN Pangan merupakan salah satu kebutuhan pokok yang sangat penting dalam…

DAMPAK MAKANAN dan MINUMAN INSTAN BAGI KESEHATAN Description: Description: logo besar

DAMPAK MAKANAN dan MINUMAN INSTAN BAGI KESEHATAN A.     PENDAHULUAN Kesadaran masyarakat untuk mengkonsumsi makanan yang bergizi dan ber…

anthropometri Lansia

BAB I PENDAHULUAN A.     LATAR BELAKANG 1.       Pengertian lansia Penduduk Lanjut Usia merupakan bagian dari anggota keluarga dan anggot…

suplemen dan kebugaran

PERKEMBANGAN MUTAKHIR GIZI DAN KEBUGARAN “SUPLEMEN DAN KEBUGARAN” A.     PENDAHULUAN Kebugaran merupakan suatu keadaan dimana tubuh s…

Baku Rujukan WHO 2005

  1. Definisi Baku Rujukan adalah tabel yang berisi daftar normatif sebagai pembanding dalam menilai status gizi. Baku Rujukan dibuat …

PERAN KELUARGA DALAM PENCEGAHAN DAN PENANGGULANGAN GIZI BURUK

BAB I PENDAHULUAN A.       DEFINISI GIZI BURUK KEP atau gizi buruk adalah suatu kondisi di mana seseorang dinyatakan kekurangan nutrisi…

pangan instan: TIwul dan gatot instan

PANGAN INSTAN A.        PENDAHULUAN Kemajuan ilmu dan   teknologi berkembang dengan pesat diberbagai bidang, termasuk dalam bidang   pan…

TANAMAN SEBAGAI ALTERNATIF PEWARNA SINTETIS

TANAMAN SEBAGAI ALTERNATIF PEWARNA SINTETIS 1.       LATAR BELAKANG Menurut Winarno (1995), yang dimaksud dengan zat pewarna adalah baha…

Fortifikasi pada minyak goreng

  1. PENDAHULUAN Fortifikasi pangan adalah penambahan satu atau lebih nutrisi pada makanan. Tujuan utama adalah untuk meningkatkan…

blogger templates

 

blogger news

 

blogroll

 

labels

 

AVAIL (2)

Kanker Serviks (3)

Powered By Blogger

Diberdayakan oleh Blogger.

You can replace this text by going to “Layout” and then “Page Elements” section. Edit ” About “

 

mengenai saya

 

Foto saya

Refika Dita Tiarapuri

Lihat profil lengkapku

pengikut

 

 

archives

 

▼ 2012 (13)

▼ Januari (13)

materi tanya jawab iptek

pangan instan: TIwul dan gatot instan

DAMPAK MAKANAN dan MINUMAN INSTAN BAGI KESEHATAN …

PENGAWETAN DENGAN TEKNIK IRADIASI

Program Penanggulangan Gizi Buruk dari Pemerintah

suplemen dan kebugaran

Baku Rujukan WHO 2005

PERAN KELUARGA DALAM PENCEGAHAN DAN PENANGGULANGAN…

Fortifikasi pada minyak goreng

anthropometri Lansia

TANAMAN SEBAGAI ALTERNATIF PEWARNA SINTETIS

MAKALAH tb/u

index masa tubuh (kel X)

► 2011 (9)

 

Copyright © Ceria Cemerlang. All rights reserved. Blogger Templates for Online Chat City

Sponsored by ChristianSoulmate.com, Over 50 Dating, Senior Citizens index massa tubuh

DISTRIBUTOR HERBALIFE
TERMURAH & ORIGINAL
-------------------------------------------------
Untuk order :
HP/SMS/WA : 0813 2011 2028
BBM : 54F4CE77 | Line : ProgramLangsing


PAKET HERBALIFE

Pilihan paket Herbalife yang bisa Anda pilih sesuai kebutuhan


PRODUK HERBALIFE

Produk-produk Herbalife ini sudah bersertifikat FDA, TGA, GMP dari USA & BPOM dari Indonesia. Dan pastinya tidak mudah untuk produk-produk yang bisa mendapatkan sertifikat ini.